SCOPe 2.04: Domain d1a47a2: 1a47 A:579-683

Lineage for d1a47a2 (1a47 A:579-683)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (4 PDB entries)

8. Domain d1a47a2: 1a47 A:579-683 [22522]
   Other proteins in same PDB: d1a47a1, d1a47a3, d1a47a4
   complexed with ca

Details for d1a47a2

PDB Entry: 1a47, 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1a47a2:

Sequence; same for both SEQRES and ATOM records:

>d1a47a2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

Timeline for d1a47a2:

• d1a47a2 first appeared (with stable ids) in SCOP 1.55, called d1a47_2
  
• d1a47a2 appears in SCOPe 2.03
  
• d1a47a2 appears in SCOPe 2.05
  
• d1a47a2 appears in the current release, SCOPe 2.08