Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (4 PDB entries) |
Domain d1a47a2: 1a47 A:579-683 [22522] Other proteins in same PDB: d1a47a1, d1a47a3, d1a47a4 complexed with ca |
PDB Entry: 1a47 (more details), 2.56 Å
SCOPe Domain Sequences for d1a47a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a47a2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq
Timeline for d1a47a2: