SCOP 1.67: Domain d1a47_2: 1a47 579-683

Lineage for d1a47_2 (1a47 579-683)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries)

8. Domain d1a47_2: 1a47 579-683 [22522]
   Other proteins in same PDB: d1a47_1, d1a47_3, d1a47_4
   complexed with ca, cyl, glc, gld, gte

Details for d1a47_2

PDB Entry: 1a47, 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor

SCOP Domain Sequences for d1a47_2:

Sequence; same for both SEQRES and ATOM records:

>d1a47_2 b.3.1.1 (579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

Timeline for d1a47_2:

• d1a47_2 first appeared (with stable ids) in SCOP 1.55
  
• d1a47_2 appears in SCOP 1.65
  
• d1a47_2 appears in SCOP 1.69
  
• d1a47_2 appears in the current release, SCOPe 2.08, called d1a47a2