Class b: All beta proteins [48724] (141 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries) |
Domain d1a47_2: 1a47 579-683 [22522] Other proteins in same PDB: d1a47_1, d1a47_3, d1a47_4 complexed with ca, cyl, glc, gld, gte |
PDB Entry: 1a47 (more details), 2.56 Å
SCOP Domain Sequences for d1a47_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a47_2 b.3.1.1 (579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1} ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq
Timeline for d1a47_2: