Lineage for d1a47_2 (1a47 579-683)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) 
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries) 
Domain d1a47_2: 1a47 579-683 [22522]
Other proteins in same PDB: d1a47_1, d1a47_3, d1a47_4
Details for d1a47_2
PDB Entry: 1a47 (more details), 2.56 Å
PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor
SCOP Domain Sequences for d1a47_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a47_2 b.3.1.1 (579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq
SCOP Domain Coordinates for d1a47_2:
Click to download the PDB-style file with coordinates for d1a47_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a47_2:
- d1a47_2 appears in SCOP 1.57
- d1a47_2 appears in the current release, SCOPe 2.08, called d1a47a2
View in 3D
