Lineage for d1a47_2 (1a47 579-683)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10553Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries)
  8. 10555Domain d1a47_2: 1a47 579-683 [22522]
    Other proteins in same PDB: d1a47_1, d1a47_3, d1a47_4

Details for d1a47_2

PDB Entry: 1a47 (more details), 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor

SCOP Domain Sequences for d1a47_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a47_2 b.3.1.1 (579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

SCOP Domain Coordinates for d1a47_2:

Click to download the PDB-style file with coordinates for d1a47_2.
(The format of our PDB-style files is described here.)

Timeline for d1a47_2: