SCOPe 2.01: Domain d1ciua2: 1ciu A:579-683

Lineage for d1ciua2 (1ciu A:579-683)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species)
   this domain is the last one in the protein chain

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries)

8. Domain d1ciua2: 1ciu A:579-683 [22521]
   Other proteins in same PDB: d1ciua1, d1ciua3, d1ciua4
   complexed with ca

Details for d1ciua2

PDB Entry: 1ciu, 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1ciua2:

Sequence; same for both SEQRES and ATOM records:

>d1ciua2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

Timeline for d1ciua2:

• d1ciua2 first appeared (with stable ids) in SCOP 1.55, called d1ciu_2
  
• d1ciua2 appears in SCOP 1.75
  
• d1ciua2 appears in SCOPe 2.02
  
• d1ciua2 appears in the current release, SCOPe 2.08