![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species) this domain is the last one in the protein chain |
![]() | Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries) |
![]() | Domain d1ciua2: 1ciu A:579-683 [22521] Other proteins in same PDB: d1ciua1, d1ciua3, d1ciua4 complexed with ca |
PDB Entry: 1ciu (more details), 2.3 Å
SCOP Domain Sequences for d1ciua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciua2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq
Timeline for d1ciua2: