Lineage for d1ciu_2 (1ciu 579-683)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 552998Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) (S)
  5. 552999Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 553031Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 553095Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries)
  8. 553096Domain d1ciu_2: 1ciu 579-683 [22521]
    Other proteins in same PDB: d1ciu_1, d1ciu_3, d1ciu_4
    complexed with ca

Details for d1ciu_2

PDB Entry: 1ciu (more details), 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

SCOP Domain Sequences for d1ciu_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciu_2 b.3.1.1 (579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

SCOP Domain Coordinates for d1ciu_2:

Click to download the PDB-style file with coordinates for d1ciu_2.
(The format of our PDB-style files is described here.)

Timeline for d1ciu_2: