Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species) this domain is the last one in the protein chain |
Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries) Uniprot P05618 |
Domain d1deda2: 1ded A:583-686 [22519] Other proteins in same PDB: d1deda1, d1deda3, d1deda4, d1dedb1, d1dedb3, d1dedb4 complexed with ca, qps |
PDB Entry: 1ded (more details), 2 Å
SCOPe Domain Sequences for d1deda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deda2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]} tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp
Timeline for d1deda2:
View in 3D Domains from other chains: (mouse over for more information) d1dedb1, d1dedb2, d1dedb3, d1dedb4 |