Lineage for d1deda2 (1ded A:583-686)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10541Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (3 PDB entries)
  8. 10546Domain d1deda2: 1ded A:583-686 [22519]
    Other proteins in same PDB: d1deda1, d1deda3, d1deda4, d1dedb1, d1dedb3, d1dedb4

Details for d1deda2

PDB Entry: 1ded (more details), 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

SCOP Domain Sequences for d1deda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deda2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOP Domain Coordinates for d1deda2:

Click to download the PDB-style file with coordinates for d1deda2.
(The format of our PDB-style files is described here.)

Timeline for d1deda2: