Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species) this domain is the last one in the protein chain |
Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries) Uniprot P05618 |
Domain d1d7fa2: 1d7f A:583-686 [22517] Other proteins in same PDB: d1d7fa1, d1d7fa3, d1d7fa4, d1d7fb1, d1d7fb3, d1d7fb4 complexed with ca |
PDB Entry: 1d7f (more details), 1.9 Å
SCOPe Domain Sequences for d1d7fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7fa2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]} tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp
Timeline for d1d7fa2:
View in 3D Domains from other chains: (mouse over for more information) d1d7fb1, d1d7fb2, d1d7fb3, d1d7fb4 |