Lineage for d1pama2 (1pam A:583-686)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55519Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 55520Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 55521Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 55531Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 55561Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (4 PDB entries)
  8. 55562Domain d1pama2: 1pam A:583-686 [22515]
    Other proteins in same PDB: d1pama1, d1pama3, d1pama4, d1pamb1, d1pamb3, d1pamb4

Details for d1pama2

PDB Entry: 1pam (more details), 1.8 Å

PDB Description: cyclodextrin glucanotransferase

SCOP Domain Sequences for d1pama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pama2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOP Domain Coordinates for d1pama2:

Click to download the PDB-style file with coordinates for d1pama2.
(The format of our PDB-style files is described here.)

Timeline for d1pama2: