SCOP 1.55: Domain d1pama2: 1pam A:583-686

Lineage for d1pama2 (1pam A:583-686)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)

7. Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (3 PDB entries)

8. Domain d1pama2: 1pam A:583-686 [22515]
   Other proteins in same PDB: d1pama1, d1pama3, d1pama4, d1pamb1, d1pamb3, d1pamb4

Details for d1pama2

PDB Entry: 1pam, 1.8 Å

PDB Description: cyclodextrin glucanotransferase

SCOP Domain Sequences for d1pama2:

Sequence; same for both SEQRES and ATOM records:

>d1pama2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

Timeline for d1pama2:

• d1pama2 appears in SCOP 1.57
  
• d1pama2 appears in the current release, SCOPe 2.08