Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries) |
Domain d1qhpa2: 1qhp A:577-686 [22514] Other proteins in same PDB: d1qhpa1, d1qhpa3, d1qhpa4 complexed with ca, mal, so4 |
PDB Entry: 1qhp (more details), 1.7 Å
SCOPe Domain Sequences for d1qhpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhpa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn
Timeline for d1qhpa2: