Lineage for d1qhoa2 (1qho A:577-686)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223936Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 223937Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 223938Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 223948Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 223991Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries)
  8. 223992Domain d1qhoa2: 1qho A:577-686 [22513]
    Other proteins in same PDB: d1qhoa1, d1qhoa3, d1qhoa4
    complexed with abd, ca, mal, so4

Details for d1qhoa2

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex

SCOP Domain Sequences for d1qhoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase}
lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf
yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn

SCOP Domain Coordinates for d1qhoa2:

Click to download the PDB-style file with coordinates for d1qhoa2.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa2: