SCOPe 2.04: Domain d1cyga2: 1cyg A:575-680

Lineage for d1cyga2 (1cyg A:575-680)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus stearothermophilus [TaxId:1422] [49456] (1 PDB entry)

8. Domain d1cyga2: 1cyg A:575-680 [22512]
   Other proteins in same PDB: d1cyga1, d1cyga3, d1cyga4
   complexed with ca

Details for d1cyga2

PDB Entry: 1cyg, 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1cyga2:

Sequence; same for both SEQRES and ATOM records:

>d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
ltndqvsvrfvvnnattnlgqniyivgnvyelgnwdtskaigpmfnqvvysyptwyidvs
vpegktiefkfikkdsqgnvtwesgsnhvyttptnttgkiivdwqn

Timeline for d1cyga2:

• d1cyga2 first appeared (with stable ids) in SCOP 1.55, called d1cyg_2
  
• d1cyga2 appears in SCOPe 2.03
  
• d1cyga2 appears in SCOPe 2.05
  
• d1cyga2 appears in the current release, SCOPe 2.08