SCOPe 2.06: Domain d6cgta2: 6cgt A:580-684

Lineage for d6cgta2 (6cgt A:580-684)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d6cgta2: 6cgt A:580-684 [22506]
   Other proteins in same PDB: d6cgta1, d6cgta3, d6cgta4
   complexed with ca; mutant

Details for d6cgta2

PDB Entry: 6cgt, 2.6 Å

PDB Description: hoxa complex of cyclodextrin glycosyltransferase mutant

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d6cgta2:

Sequence; same for both SEQRES and ATOM records:

>d6cgta2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

Timeline for d6cgta2:

• d6cgta2 first appeared (with stable ids) in SCOP 1.55, called d6cgt_2
  
• d6cgta2 appears in SCOPe 2.05
  
• d6cgta2 appears in SCOPe 2.07
  
• d6cgta2 appears in the current release, SCOPe 2.08