Lineage for d1cxka2 (1cxk A:584-686)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10512Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries)
  8. 10528Domain d1cxka2: 1cxk A:584-686 [22504]
    Other proteins in same PDB: d1cxka1, d1cxka3, d1cxka4

Details for d1cxka2

PDB Entry: 1cxk (more details), 2.09 Å

PDB Description: complex between a maltononaose substrate and bacillus circulans strain 251 cgtase e257q/d229n

SCOP Domain Sequences for d1cxka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxka2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1cxka2:

Click to download the PDB-style file with coordinates for d1cxka2.
(The format of our PDB-style files is described here.)

Timeline for d1cxka2: