Lineage for d1tcmb2 (1tcm B:582-686)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1301409Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 1301410Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 1301446Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 1301447Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 1301478Domain d1tcmb2: 1tcm B:582-686 [22503]
    Other proteins in same PDB: d1tcma1, d1tcma3, d1tcma4, d1tcmb1, d1tcmb3, d1tcmb4
    complexed with ca; mutant

Details for d1tcmb2

PDB Entry: 1tcm (more details), 2.2 Å

PDB Description: cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
PDB Compounds: (B:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1tcmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcmb2 b.3.1.1 (B:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnadpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOPe Domain Coordinates for d1tcmb2:

Click to download the PDB-style file with coordinates for d1tcmb2.
(The format of our PDB-style files is described here.)

Timeline for d1tcmb2: