SCOPe 2.04: Domain d8cgta2: 8cgt A:580-684

Lineage for d8cgta2 (8cgt A:580-684)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d8cgta2: 8cgt A:580-684 [22500]
   Other proteins in same PDB: d8cgta1, d8cgta3, d8cgta4
   complexed with ca, tm6

Details for d8cgta2

PDB Entry: 8cgt, 2.4 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose

PDB Compounds: (A:) protein (cyclodextrin-glycosyltransferase)

SCOPe Domain Sequences for d8cgta2:

Sequence; same for both SEQRES and ATOM records:

>d8cgta2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

Timeline for d8cgta2:

• d8cgta2 first appeared (with stable ids) in SCOP 1.55
  
• d8cgta2 appears in SCOPe 2.03
  
• d8cgta2 appears in SCOPe 2.05
  
• d8cgta2 appears in the current release, SCOPe 2.08