Lineage for d1cxla2 (1cxl A:584-686)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries) 
Domain d1cxla2: 1cxl A:584-686 [22498]
Other proteins in same PDB: d1cxla1, d1cxla3, d1cxla4
Details for d1cxla2
PDB Entry: 1cxl (more details), 1.81 Å
PDB Description: complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
SCOP Domain Sequences for d1cxla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxla2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
SCOP Domain Coordinates for d1cxla2:
Click to download the PDB-style file with coordinates for d1cxla2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxla2:
- d1cxla2 appears in SCOP 1.57
- d1cxla2 appears in the current release, SCOPe 2.08
View in 3D
