Lineage for d7cgt_2 (7cgt 582-684)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10512Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries)
  8. 10540Domain d7cgt_2: 7cgt 582-684 [22495]
    Other proteins in same PDB: d7cgt_1, d7cgt_3, d7cgt_4

Details for d7cgt_2

PDB Entry: 7cgt (more details), 3 Å

PDB Description: rameb complex of cyclodextrin glycosyltransferase mutant

SCOP Domain Sequences for d7cgt_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cgt_2 b.3.1.1 (582-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
gdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsv
pagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

SCOP Domain Coordinates for d7cgt_2:

Click to download the PDB-style file with coordinates for d7cgt_2.
(The format of our PDB-style files is described here.)

Timeline for d7cgt_2: