SCOP 1.75: Domain d5cgta2: 5cgt A:582-684

Lineage for d5cgta2 (5cgt A:582-684)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d5cgta2: 5cgt A:582-684 [22493]
   Other proteins in same PDB: d5cgta1, d5cgta3, d5cgta4
   complexed with ca, glc; mutant

Details for d5cgta2

PDB Entry: 5cgt, 2.5 Å

PDB Description: maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d5cgta2:

Sequence; same for both SEQRES and ATOM records:

>d5cgta2 b.3.1.1 (A:582-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
gdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsv
pagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

Timeline for d5cgta2:

• d5cgta2 first appeared (with stable ids) in SCOP 1.55, called d5cgt_2
  
• d5cgta2 appears in SCOP 1.73
  
• d5cgta2 appears in SCOPe 2.01
  
• d5cgta2 appears in the current release, SCOPe 2.08