Lineage for d1cxh_2 (1cxh 582-686)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries) 
Domain d1cxh_2: 1cxh 582-686 [22490]
Other proteins in same PDB: d1cxh_1, d1cxh_3, d1cxh_4
Details for d1cxh_2
PDB Entry: 1cxh (more details), 2.4 Å
PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.6 based on diffraction data of a crystal soaked with maltoheptaose
SCOP Domain Sequences for d1cxh_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxh_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
SCOP Domain Coordinates for d1cxh_2:
Click to download the PDB-style file with coordinates for d1cxh_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxh_2:
- d1cxh_2 appears in SCOP 1.57
- d1cxh_2 appears in the current release, SCOPe 2.08, called d1cxha2
View in 3D
