Lineage for d1cgv_2 (1cgv 582-686)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55519Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 55520Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 55521Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 55531Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 55532Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries)
  8. 55542Domain d1cgv_2: 1cgv 582-686 [22489]
    Other proteins in same PDB: d1cgv_1, d1cgv_3, d1cgv_4

Details for d1cgv_2

PDB Entry: 1cgv (more details), 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgv_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgv_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1cgv_2:

Click to download the PDB-style file with coordinates for d1cgv_2.
(The format of our PDB-style files is described here.)

Timeline for d1cgv_2: