SCOPe 2.03: Domain d1cxia2: 1cxi A:582-686

Lineage for d1cxia2 (1cxi A:582-686)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1cxia2: 1cxi A:582-686 [22487]
   Other proteins in same PDB: d1cxia1, d1cxia3, d1cxia4
   complexed with ca, mal

Details for d1cxia2

PDB Entry: 1cxi, 2.2 Å

PDB Description: wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1cxia2:

Sequence; same for both SEQRES and ATOM records:

>d1cxia2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1cxia2:

• d1cxia2 first appeared (with stable ids) in SCOP 1.55, called d1cxi_2
  
• d1cxia2 appears in SCOPe 2.02
  
• d1cxia2 appears in SCOPe 2.04
  
• d1cxia2 appears in the current release, SCOPe 2.08