Lineage for d4m9db1 (4m9d B:1-428)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128283Species Bacillus anthracis [TaxId:261594] [224889] (2 PDB entries)
  8. 2128285Domain d4m9db1: 4m9d B:1-428 [224837]
    Other proteins in same PDB: d4m9db2
    automated match to d3r7ta_
    complexed with amp, edo, fmt, mli, po4

Details for d4m9db1

PDB Entry: 4m9d (more details), 1.82 Å

PDB Description: The Crystal structure of an adenylosuccinate synthetase from Bacillus anthracis str. Ames Ancestor in complex with AMP.
PDB Compounds: (B:) adenylosuccinate synthetase

SCOPe Domain Sequences for d4m9db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m9db1 c.37.1.0 (B:1-428) automated matches {Bacillus anthracis [TaxId: 261594]}
mssvvvvgtqwgdegkgkitdflsehaevvaryqggnnaghtivfggvkyklhlipsgif
ykekicvignglvvdpkalleelkylhdrgvstdnlrvsnrahvilpyhlkqdeleeask
gdnkigttkkgigpaymdkaarigirmadlldreafkekleqnlaqknrlfekmydtegf
svdeifeeyfeygqqiaqyvcdtsvvlndaldnnhrvlfegaqgvmldidhgtypfvtss
npiaggvtvgtgvgpakvtrvvgvckaytsrvgdgpfptelhdeighqirevgreygttt
grprrvgwfdsvvvrharrvsgltdlslnsidvltgiptlkicvaykcdgkvidevpanl
nilakcepvceelpgwteditgvrsldelpenarkyvervseltgiqlsmfsvgpdrnqt
nivrnvye

SCOPe Domain Coordinates for d4m9db1:

Click to download the PDB-style file with coordinates for d4m9db1.
(The format of our PDB-style files is described here.)

Timeline for d4m9db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m9db2
View in 3D
Domains from other chains:
(mouse over for more information)
d4m9da_