Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [224889] (2 PDB entries) |
Domain d4m9db1: 4m9d B:1-428 [224837] Other proteins in same PDB: d4m9db2 automated match to d3r7ta_ complexed with amp, edo, fmt, mli, po4 |
PDB Entry: 4m9d (more details), 1.82 Å
SCOPe Domain Sequences for d4m9db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m9db1 c.37.1.0 (B:1-428) automated matches {Bacillus anthracis [TaxId: 261594]} mssvvvvgtqwgdegkgkitdflsehaevvaryqggnnaghtivfggvkyklhlipsgif ykekicvignglvvdpkalleelkylhdrgvstdnlrvsnrahvilpyhlkqdeleeask gdnkigttkkgigpaymdkaarigirmadlldreafkekleqnlaqknrlfekmydtegf svdeifeeyfeygqqiaqyvcdtsvvlndaldnnhrvlfegaqgvmldidhgtypfvtss npiaggvtvgtgvgpakvtrvvgvckaytsrvgdgpfptelhdeighqirevgreygttt grprrvgwfdsvvvrharrvsgltdlslnsidvltgiptlkicvaykcdgkvidevpanl nilakcepvceelpgwteditgvrsldelpenarkyvervseltgiqlsmfsvgpdrnqt nivrnvye
Timeline for d4m9db1: