SCOPe 2.07: Domain d4m61c1: 4m61 C:1-112

Lineage for d4m61c1 (4m61 C:1-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d4m61c1: 4m61 C:1-112 [224831]
   Other proteins in same PDB: d4m61a2, d4m61c2
   automated match to d1dqdl1
   complexed with so4

Details for d4m61c1

PDB Entry: 4m61, 1.62 Å

PDB Description: Crystal structure of unliganded anti-DNA Fab A52

PDB Compounds: (C:) Fab A52 light chain

SCOPe Domain Sequences for d4m61c1:

Sequence; same for both SEQRES and ATOM records:

>d4m61c1 b.1.1.0 (C:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nimmtqspsslavsagekvtmsckssqsvlyssnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyychqhlsswtfgggtkleik

Timeline for d4m61c1:

• d4m61c1 first appeared in SCOPe 2.03
  
• d4m61c1 appears in SCOPe 2.06
  
• d4m61c1 appears in the current release, SCOPe 2.08