SCOP 1.73: Domain d1bxxa_: 1bxx A:

Lineage for d1bxxa_ (1bxx A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (1 family)
   duplication: one domain of this fold is inserted into another domain of the same fold

5. Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein)

6. Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49450] (6 PDB entries)

8. Domain d1bxxa_: 1bxx A: [22483]

Details for d1bxxa_

PDB Entry: 1bxx, 2.7 Å

PDB Description: mu2 adaptin subunit (ap50) of ap2 adaptor (second domain), complexed with tgn38 internalization peptide dyqrln

PDB Compounds: (A:) protein (ap50)

SCOP Domain Sequences for d1bxxa_:

Sequence, based on SEQRES records:

>d1bxxa_ b.2.7.1 (A:) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kiviekqgkgtadetsksgkqsiaiddctfhqcvrlskfdsersisfippdgefelmryr
ttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicm
kgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsg
lkvrylkvfepklnysdhdvikwvryigrsgiyetrc

Sequence, based on observed residues (ATOM records):

>d1bxxa_ b.2.7.1 (A:) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kikqsiaiddctfhqcvrlsersisfippdgefelmryrttkdiilpfrviplvrevgrt
klevkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrma
gmkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvi
kwvryigrsgiyetrc

Timeline for d1bxxa_:

• d1bxxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxxa_ appears in SCOP 1.71
  
• d1bxxa_ appears in SCOP 1.75
  
• d1bxxa_ appears in the current release, SCOPe 2.08