Lineage for d1bxxa_ (1bxx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768498Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 2768499Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein)
    automatically mapped to Pfam PF00928
  6. 2768500Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species)
  7. 2768503Species Norway rat (Rattus norvegicus) [TaxId:10116] [49450] (6 PDB entries)
  8. 2768507Domain d1bxxa_: 1bxx A: [22483]

Details for d1bxxa_

PDB Entry: 1bxx (more details), 2.7 Å

PDB Description: mu2 adaptin subunit (ap50) of ap2 adaptor (second domain), complexed with tgn38 internalization peptide dyqrln
PDB Compounds: (A:) protein (ap50)

SCOPe Domain Sequences for d1bxxa_:

Sequence, based on SEQRES records: (download)

>d1bxxa_ b.2.7.1 (A:) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kiviekqgkgtadetsksgkqsiaiddctfhqcvrlskfdsersisfippdgefelmryr
ttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicm
kgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsg
lkvrylkvfepklnysdhdvikwvryigrsgiyetrc

Sequence, based on observed residues (ATOM records): (download)

>d1bxxa_ b.2.7.1 (A:) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kikqsiaiddctfhqcvrlsersisfippdgefelmryrttkdiilpfrviplvrevgrt
klevkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrma
gmkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvi
kwvryigrsgiyetrc

SCOPe Domain Coordinates for d1bxxa_:

Click to download the PDB-style file with coordinates for d1bxxa_.
(The format of our PDB-style files is described here.)

Timeline for d1bxxa_: