Lineage for d4m1qb2 (4m1q B:145-315)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233150Species Bacillus selenitireducens [TaxId:439292] [226756] (1 PDB entry)
  8. 2233152Domain d4m1qb2: 4m1q B:145-315 [224816]
    Other proteins in same PDB: d4m1qa1, d4m1qb1
    automated match to d5ldha2
    complexed with mpd, po4

Details for d4m1qb2

PDB Entry: 4m1q (more details), 1.6 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus selenitireducens mls10, nysgrc target 029814.
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4m1qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1qb2 d.162.1.0 (B:145-315) automated matches {Bacillus selenitireducens [TaxId: 439292]}
sgtildtarfrfllseyfdidvrnihgyimgehgdtelpvwsqtrigsepisrymdkykp
dgsnkdldeifvnvrdaayhiierkgathyaiamglarltkailrneqsiltvstlmege
ydlddvyigvpaivsqkgveraieidlndeemkklhhssntlkdvmkpifd

SCOPe Domain Coordinates for d4m1qb2:

Click to download the PDB-style file with coordinates for d4m1qb2.
(The format of our PDB-style files is described here.)

Timeline for d4m1qb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m1qb1