Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Bacillus selenitireducens [TaxId:439292] [226755] (1 PDB entry) |
Domain d4m1qb1: 4m1q B:4-144 [224815] Other proteins in same PDB: d4m1qa2, d4m1qb2 automated match to d5ldha1 complexed with mpd, po4 |
PDB Entry: 4m1q (more details), 1.6 Å
SCOPe Domain Sequences for d4m1qb1:
Sequence, based on SEQRES records: (download)
>d4m1qb1 c.2.1.0 (B:4-144) automated matches {Bacillus selenitireducens [TaxId: 439292]} ktsrvviigtgavgssyafsminqnvtdemvlidldkrktegdamdlnhgipfgaptkvw agdygdcksadivvitagaaqkpgetrldlveknanifkgivdqvmgsgfngifiiatnp vdvlayatwkfsglpkervig
>d4m1qb1 c.2.1.0 (B:4-144) automated matches {Bacillus selenitireducens [TaxId: 439292]} ktsrvviigtgavgssyafsminqnvtdemvlidldkrktegdamdlnhgipfgaptkvw agdygdcksadivvitagaagetrldlveknanifkgivdqvmgsgfngifiiatnpvdv layatwkfsglpkervig
Timeline for d4m1qb1: