SCOPe 2.04: Domain d4m1qa2: 4m1q A:145-314

Lineage for d4m1qa2 (4m1q A:145-314)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (24 species)
   not a true protein

7. Species Bacillus selenitireducens [TaxId:439292] [226756] (1 PDB entry)

8. Domain d4m1qa2: 4m1q A:145-314 [224814]
   Other proteins in same PDB: d4m1qa1, d4m1qb1
   automated match to d5ldha2
   complexed with mpd, po4

Details for d4m1qa2

PDB Entry: 4m1q, 1.6 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus selenitireducens mls10, nysgrc target 029814.

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4m1qa2:

Sequence; same for both SEQRES and ATOM records:

>d4m1qa2 d.162.1.0 (A:145-314) automated matches {Bacillus selenitireducens [TaxId: 439292]}
sgtildtarfrfllseyfdidvrnihgyimgehgdtelpvwsqtrigsepisrymdkykp
dgsnkdldeifvnvrdaayhiierkgathyaiamglarltkailrneqsiltvstlmege
ydlddvyigvpaivsqkgveraieidlndeemkklhhssntlkdvmkpif

Timeline for d4m1qa2:

• d4m1qa2 first appeared in SCOPe 2.03
  
• d4m1qa2 appears in SCOPe 2.05
  
• d4m1qa2 appears in the current release, SCOPe 2.08