Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Bacillus selenitireducens [TaxId:439292] [226756] (1 PDB entry) |
Domain d4m1qa2: 4m1q A:145-314 [224814] Other proteins in same PDB: d4m1qa1, d4m1qb1 automated match to d5ldha2 complexed with mpd, po4 |
PDB Entry: 4m1q (more details), 1.6 Å
SCOPe Domain Sequences for d4m1qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m1qa2 d.162.1.0 (A:145-314) automated matches {Bacillus selenitireducens [TaxId: 439292]} sgtildtarfrfllseyfdidvrnihgyimgehgdtelpvwsqtrigsepisrymdkykp dgsnkdldeifvnvrdaayhiierkgathyaiamglarltkailrneqsiltvstlmege ydlddvyigvpaivsqkgveraieidlndeemkklhhssntlkdvmkpif
Timeline for d4m1qa2: