SCOPe 2.06: Domain d4m1qa1: 4m1q A:3-144

Lineage for d4m1qa1 (4m1q A:3-144)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Bacillus selenitireducens [TaxId:439292] [226755] (1 PDB entry)

8. Domain d4m1qa1: 4m1q A:3-144 [224813]
   Other proteins in same PDB: d4m1qa2, d4m1qb2
   automated match to d5ldha1
   complexed with mpd, po4

Details for d4m1qa1

PDB Entry: 4m1q, 1.6 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus selenitireducens mls10, nysgrc target 029814.

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4m1qa1:

Sequence; same for both SEQRES and ATOM records:

>d4m1qa1 c.2.1.0 (A:3-144) automated matches {Bacillus selenitireducens [TaxId: 439292]}
tktsrvviigtgavgssyafsminqnvtdemvlidldkrktegdamdlnhgipfgaptkv
wagdygdcksadivvitagaaqkpgetrldlveknanifkgivdqvmgsgfngifiiatn
pvdvlayatwkfsglpkervig

Timeline for d4m1qa1:

• d4m1qa1 first appeared in SCOPe 2.03
  
• d4m1qa1 appears in SCOPe 2.05
  
• d4m1qa1 appears in SCOPe 2.07
  
• d4m1qa1 appears in the current release, SCOPe 2.08