Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (12 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries) |
Domain d4m1na_: 4m1n A: [224810] Other proteins in same PDB: d4m1nb2 automated match to d2grra_ complexed with na |
PDB Entry: 4m1n (more details), 1.5 Å
SCOPe Domain Sequences for d4m1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m1na_ d.20.1.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} siakkrlaqeraewrkdhpagfsakyspmsdgkgldimkwickipgkkgglweggeyplt meftedypskppkckfttvlfhpniypsgtvclsilnededwkpsitikqillgiqdlld npnpnspaqaepfllyqqdrdsyekkvkkqaiefrpkd
Timeline for d4m1na_: