SCOPe 2.06: Domain d4m1na_: 4m1n A:

Lineage for d4m1na_ (4m1n A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries)

8. Domain d4m1na_: 4m1n A: [224810]
   Other proteins in same PDB: d4m1nb2
   automated match to d2grra_
   complexed with na

Details for d4m1na_

PDB Entry: 4m1n, 1.5 Å

PDB Description: crystal structure of plasmodium falciparum ubiquitin conjugating enzyme ubc9

PDB Compounds: (A:) Ubiquitin conjugating enzyme UBC9

SCOPe Domain Sequences for d4m1na_:

Sequence; same for both SEQRES and ATOM records:

>d4m1na_ d.20.1.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
siakkrlaqeraewrkdhpagfsakyspmsdgkgldimkwickipgkkgglweggeyplt
meftedypskppkckfttvlfhpniypsgtvclsilnededwkpsitikqillgiqdlld
npnpnspaqaepfllyqqdrdsyekkvkkqaiefrpkd

Timeline for d4m1na_:

• d4m1na_ first appeared in SCOPe 2.03
  
• d4m1na_ appears in SCOPe 2.05
  
• d4m1na_ appears in SCOPe 2.07
  
• d4m1na_ appears in the current release, SCOPe 2.08