SCOPe 2.06: Domain d4m1ed_: 4m1e D:

Lineage for d4m1ed_ (4m1e D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Planctomyces limnophilus [TaxId:521674] [226754] (1 PDB entry)

8. Domain d4m1ed_: 4m1e D: [224807]
   automated match to d1tcva_
   complexed with 6pc, ade, so4

Details for d4m1ed_

PDB Entry: 4m1e, 1.9 Å

PDB Description: crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364.

PDB Compounds: (D:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4m1ed_:

Sequence; same for both SEQRES and ATOM records:

>d4m1ed_ c.56.2.0 (D:) automated matches {Planctomyces limnophilus [TaxId: 521674]}
selksridqatakisqlwqgepavgmilgtglgglaeqieqdiaipysdiphfptstvks
hagrlvcgrlrgipivamegrfhyyegysleqvtfpvrvmkamgvktllvtnaagginpq
ldlsdvliiedhinlmpenplrgpndeelgprfpdmshpydcqhmevarqvalelgihcp
kgvfvavsgpnletraeyrmlklmgadvvgmstvpevlvavhaglrvlgfsvvtdlclpd
alepvelnkilevaarggaklarlipeilpria

Timeline for d4m1ed_:

• d4m1ed_ first appeared in SCOPe 2.03
  
• d4m1ed_ appears in SCOPe 2.05
  
• d4m1ed_ appears in SCOPe 2.07
  
• d4m1ed_ appears in the current release, SCOPe 2.08