Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Rhodothermus marinus [TaxId:518766] [226752] (1 PDB entry) |
Domain d4m0kb_: 4m0k B: [224801] automated match to d1zn8b_ complexed with amp, ca |
PDB Entry: 4m0k (more details), 1.4 Å
SCOPe Domain Sequences for d4m0kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m0kb_ c.61.1.0 (B:) automated matches {Rhodothermus marinus [TaxId: 518766]} taletlkqairtvpdfpepgiqfkditpvlghpellrlaieallepfqeqeitkvvgies rgfilggmlahhldagfvpvrkkgklpyqtlaesyqleygtdtiemhidaiepgdrvlih ddviatggtaeatirlveraggevvgcaflieltglqgrkrlpahvpvhtvlql
Timeline for d4m0kb_: