SCOPe 2.05: Domain d1ci3m1: 1ci3 M:1-169,M:232-249

Lineage for d1ci3m1 (1ci3 M:1-169,M:232-249)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family)

5. Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)

6. Protein Cytochrome f, large domain [49443] (5 species)
   this domain is interrupted by a small domain which is barrel-sandwich hybrid fold

7. Species Phormidium laminosum [TaxId:32059] [49446] (1 PDB entry)

8. Domain d1ci3m1: 1ci3 M:1-169,M:232-249 [22480]
   Other proteins in same PDB: d1ci3m2
   complexed with hem, zn

Details for d1ci3m1

PDB Entry: 1ci3, 1.9 Å

PDB Description: cytochrome f from the b6f complex of phormidium laminosum

PDB Compounds: (M:) protein (cytochrome f)

SCOPe Domain Sequences for d1ci3m1:

Sequence; same for both SEQRES and ATOM records:

>d1ci3m1 b.2.6.1 (M:1-169,M:232-249) Cytochrome f, large domain {Phormidium laminosum [TaxId: 32059]}
ypfwaqqnyanpreatgrivcanchlaakpaeievpqavlpdsvfkavvkipydhsvqqv
qadgskgplnvgavlmlpegftiapedripeemkeevgpsylfqpyaddkqnivlvgplp
gdeyeeivfpvlspnpatnksvafgkysihlganrgrgqiyptgeksnnXnvggfgqkdt
eivlqspn

Timeline for d1ci3m1:

• d1ci3m1 first appeared (with stable ids) in SCOP 1.55
  
• d1ci3m1 appears in SCOPe 2.04
  
• d1ci3m1 appears in SCOPe 2.06
  
• d1ci3m1 appears in the current release, SCOPe 2.08