Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) |
Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein) |
Protein Cytochrome f, large domain [49443] (5 species) this domain is interrupted by a small domain which is barrel-sandwich hybrid fold |
Species Chlamydomonas reinhardtii [TaxId:3055] [49445] (6 PDB entries) |
Domain d1e2zb1: 1e2z B:1-168,B:233-251 [22478] Other proteins in same PDB: d1e2za2, d1e2zb2, d1e2zc2 |
PDB Entry: 1e2z (more details), 2.5 Å
SCOP Domain Sequences for d1e2zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2zb1 b.2.6.1 (B:1-168,B:233-251) Cytochrome f, large domain {Chlamydomonas reinhardtii [TaxId: 3055]} ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg kkysemvvpilspdpaknknvsylkypiyfggnrgrglvypdgkksnnXnvggfgqaete ivlqnpar
Timeline for d1e2zb1:
View in 3D Domains from other chains: (mouse over for more information) d1e2za1, d1e2za2, d1e2zc1, d1e2zc2 |