SCOP 1.75: Domain d1e2zb1: 1e2z B:1-168,B:233-251

Lineage for d1e2zb1 (1e2z B:1-168,B:233-251)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family)

5. Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)

6. Protein Cytochrome f, large domain [49443] (5 species)
   this domain is interrupted by a small domain which is barrel-sandwich hybrid fold

7. Species Chlamydomonas reinhardtii [TaxId:3055] [49445] (6 PDB entries)

8. Domain d1e2zb1: 1e2z B:1-168,B:233-251 [22478]
   Other proteins in same PDB: d1e2za2, d1e2zb2, d1e2zc2

Details for d1e2zb1

PDB Entry: 1e2z, 2.5 Å

PDB Description: q158l mutant of cytochrome f from chlamydomonas reinhardtii

PDB Compounds: (B:) cytochrome f

SCOP Domain Sequences for d1e2zb1:

Sequence; same for both SEQRES and ATOM records:

>d1e2zb1 b.2.6.1 (B:1-168,B:233-251) Cytochrome f, large domain {Chlamydomonas reinhardtii [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrglvypdgkksnnXnvggfgqaete
ivlqnpar

Timeline for d1e2zb1:

• d1e2zb1 first appeared (with stable ids) in SCOP 1.55
  
• d1e2zb1 appears in SCOP 1.73
  
• d1e2zb1 appears in SCOPe 2.01
  
• d1e2zb1 appears in the current release, SCOPe 2.08