SCOPe 2.06: Domain d4lwra1: 4lwr A:1-193

Lineage for d4lwra1 (4lwr A:1-193)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (10 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (16 PDB entries)

8. Domain d4lwra1: 4lwr A:1-193 [224777]
   Other proteins in same PDB: d4lwra2
   automated match to d4jy7a_
   protein/RNA complex; complexed with ar3, gol, po4

Details for d4lwra1

PDB Entry: 4lwr, 1.1 Å

PDB Description: crystal structure of the ternary complex of peptidyl trna hydrolase from acinetobacter baumannii with cytosine arabinoside and phosphate ion at 1.1a resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4lwra1:

Sequence; same for both SEQRES and ATOM records:

>d4lwra1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d4lwra1:

• d4lwra1 first appeared in SCOPe 2.03, called d4lwra_
  
• d4lwra1 was called d4lwra_ in SCOPe 2.05
  
• d4lwra1 does not appear in SCOPe 2.07