Lineage for d4lwra_ (4lwr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1861838Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 1861852Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 1861853Protein automated matches [193326] (7 species)
    not a true protein
  7. 1861854Species Acinetobacter baumannii [TaxId:575584] [196867] (11 PDB entries)
  8. 1861855Domain d4lwra_: 4lwr A: [224777]
    automated match to d4jy7a_
    protein/RNA complex; complexed with ar3, gol, po4

Details for d4lwra_

PDB Entry: 4lwr (more details), 1.1 Å

PDB Description: crystal structure of the ternary complex of peptidyl trna hydrolase from acinetobacter baumannii with cytosine arabinoside and phosphate ion at 1.1a resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4lwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lwra_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
gqvpqamnqinaykpa

SCOPe Domain Coordinates for d4lwra_:

Click to download the PDB-style file with coordinates for d4lwra_.
(The format of our PDB-style files is described here.)

Timeline for d4lwra_: