SCOPe 2.03: Domain d4lwra_: 4lwr A:

Lineage for d4lwra_ (4lwr A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (5 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (11 PDB entries)

8. Domain d4lwra_: 4lwr A: [224777]
   automated match to d4jy7a_
   protein/RNA complex; complexed with ar3, gol, po4

Details for d4lwra_

PDB Entry: 4lwr, 1.1 Å

PDB Description: crystal structure of the ternary complex of peptidyl trna hydrolase from acinetobacter baumannii with cytosine arabinoside and phosphate ion at 1.1a resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4lwra_:

Sequence; same for both SEQRES and ATOM records:

>d4lwra_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
gqvpqamnqinaykpa

Timeline for d4lwra_:

• d4lwra_ is new in SCOPe 2.03-stable
  
• d4lwra_ appears in SCOPe 2.04
  
• d4lwra_ last appears in SCOPe 2.06, called d4lwra1