SCOPe 2.07: Domain d4lwqa1: 4lwq A:1-193

Lineage for d4lwqa1 (4lwq A:1-193)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries)

8. Domain d4lwqa1: 4lwq A:1-193 [224776]
   Other proteins in same PDB: d4lwqa2
   automated match to d4jy7a_
   complexed with gol

Details for d4lwqa1

PDB Entry: 4lwq, 1.38 Å

PDB Description: Crystal structure of native peptidyl t-RNA hydrolase from Acinetobacter baumannii at 1.38A resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4lwqa1:

Sequence; same for both SEQRES and ATOM records:

>d4lwqa1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d4lwqa1:

• d4lwqa1 first appeared in SCOPe 2.03, called d4lwqa_
  
• d4lwqa1 appears in SCOPe 2.06
  
• d4lwqa1 appears in the current release, SCOPe 2.08