Lineage for d1ewhb1 (1ewh B:1-168,B:233-251)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10469Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 10470Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 10471Protein Cytochrome f, large domain [49443] (3 species)
  7. 10472Species Chlamydomonas reinhardtii [TaxId:3055] [49445] (5 PDB entries)
  8. 10482Domain d1ewhb1: 1ewh B:1-168,B:233-251 [22475]
    Other proteins in same PDB: d1ewha2, d1ewhb2, d1ewhc2

Details for d1ewhb1

PDB Entry: 1ewh (more details), 2.35 Å

PDB Description: structure of cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1ewhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewhb1 b.2.6.1 (B:1-168,B:233-251) Cytochrome f, large domain {Chlamydomonas reinhardtii}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnnXnvggfgqaete
ivlqnpar

SCOP Domain Coordinates for d1ewhb1:

Click to download the PDB-style file with coordinates for d1ewhb1.
(The format of our PDB-style files is described here.)

Timeline for d1ewhb1: