SCOPe 2.04: Domain d4lpfa1: 4lpf A:10-95

Lineage for d4lpfa1 (4lpf A:10-95)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (16 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225380] (3 PDB entries)

8. Domain d4lpfa1: 4lpf A:10-95 [224743]
   automated match to d2f1da1
   complexed with 3tr, mn

Details for d4lpfa1

PDB Entry: 4lpf, 2.3 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d4lpfa1:

Sequence; same for both SEQRES and ATOM records:

>d4lpfa1 d.14.1.0 (A:10-95) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srrarierrtresdivieldldgtgqvavdtgvpfydhmltalgshasfdltvratgdve
ieahhtiedtaialgtalgqalgdkr

Timeline for d4lpfa1:

• d4lpfa1 first appeared in SCOPe 2.03
  
• d4lpfa1 appears in SCOPe 2.05
  
• d4lpfa1 appears in the current release, SCOPe 2.08