Lineage for d4louf1 (4lou F:1-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511917Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1511937Domain d4louf1: 4lou F:1-106 [224741]
    Other proteins in same PDB: d4loua_, d4loub_, d4louc1, d4louc2, d4loud2, d4loue1, d4loue2, d4louf2
    automated match to d1otsd1
    mutant

Details for d4louf1

PDB Entry: 4lou (more details), 2.98 Å

PDB Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in the absence of halide
PDB Compounds: (F:) Fab light chain

SCOPe Domain Sequences for d4louf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4louf1 b.1.1.1 (F:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d4louf1:

Click to download the PDB-style file with coordinates for d4louf1.
(The format of our PDB-style files is described here.)

Timeline for d4louf1: