Lineage for d1cfmc1 (1cfm C:1-168,C:233-251)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 457013Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 457014Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 457015Protein Cytochrome f, large domain [49443] (4 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 457016Species Chlamydomonas reinhardtii [TaxId:3055] [49445] (6 PDB entries)
  8. 457024Domain d1cfmc1: 1cfm C:1-168,C:233-251 [22473]
    Other proteins in same PDB: d1cfma2, d1cfmb2, d1cfmc2

Details for d1cfmc1

PDB Entry: 1cfm (more details), 2 Å

PDB Description: cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1cfmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfmc1 b.2.6.1 (C:1-168,C:233-251) Cytochrome f, large domain {Chlamydomonas reinhardtii}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnnXnvggfgqaete
ivlqnpar

SCOP Domain Coordinates for d1cfmc1:

Click to download the PDB-style file with coordinates for d1cfmc1.
(The format of our PDB-style files is described here.)

Timeline for d1cfmc1: