Class a: All alpha proteins [46456] (289 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (37 species) not a true protein |
Species Roseobacter denitrificans [TaxId:375451] [226733] (2 PDB entries) |
Domain d4lltb1: 4llt B:1-289 [224704] Other proteins in same PDB: d4llta2, d4lltb2 automated match to d3lvsa_ complexed with ca, ipe |
PDB Entry: 4llt (more details), 1.55 Å
SCOPe Domain Sequences for d4lltb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lltb1 a.128.1.0 (B:1-289) automated matches {Roseobacter denitrificans [TaxId: 375451]} mftqrldaaaaavqahfdkvlaafeplpiveamahatsggkrlrgflvletarlhdiaag eaiwsataiealhayslvhddlpcmdnddmrrgqptvhkkwddatavlagdalqtlafel vthpgasasaevradlalslarasgaqgmvlgqaldiaaetaraplsldeitrlqqgktg aligwsaqagarlaqadtaalkryaqalglafqiaddildvtgdsaqvgkavgkdasagk atfvsllgldaararamslideacdslatygakadtlretarfvvrrth
Timeline for d4lltb1: