Lineage for d4llta1 (4llt A:1-289)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014755Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2014756Protein automated matches [196409] (37 species)
    not a true protein
  7. 2014872Species Roseobacter denitrificans [TaxId:375451] [226733] (2 PDB entries)
  8. 2014875Domain d4llta1: 4llt A:1-289 [224703]
    Other proteins in same PDB: d4llta2, d4lltb2
    automated match to d3lvsa_
    complexed with ca, ipe

Details for d4llta1

PDB Entry: 4llt (more details), 1.55 Å

PDB Description: crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with two ipp and calcium bound in active site
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d4llta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llta1 a.128.1.0 (A:1-289) automated matches {Roseobacter denitrificans [TaxId: 375451]}
mftqrldaaaaavqahfdkvlaafeplpiveamahatsggkrlrgflvletarlhdiaag
eaiwsataiealhayslvhddlpcmdnddmrrgqptvhkkwddatavlagdalqtlafel
vthpgasasaevradlalslarasgaqgmvlgqaldiaaetaraplsldeitrlqqgktg
aligwsaqagarlaqadtaalkryaqalglafqiaddildvtgdsaqvgkavgkdasagk
atfvsllgldaararamslideacdslatygakadtlretarfvvrrth

SCOPe Domain Coordinates for d4llta1:

Click to download the PDB-style file with coordinates for d4llta1.
(The format of our PDB-style files is described here.)

Timeline for d4llta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4llta2