Lineage for d4llsa_ (4lls A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749121Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1749122Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1749472Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1749473Protein automated matches [196409] (30 species)
    not a true protein
  7. 1749572Species Roseobacter denitrificans [TaxId:375451] [226733] (2 PDB entries)
  8. 1749573Domain d4llsa_: 4lls A: [224701]
    automated match to d3lvsa_
    complexed with ca, gst, ipe

Details for d4llsa_

PDB Entry: 4lls (more details), 1.5 Å

PDB Description: crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with ipp, gspp, and calcium bound in active site
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d4llsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llsa_ a.128.1.0 (A:) automated matches {Roseobacter denitrificans [TaxId: 375451]}
dlgtenlyfqsmftqrldaaaaavqahfdkvlaafeplpiveamahatsggkrlrgflvl
etarlhdiaageaiwsataiealhayslvhddlpcmdnddmrrgqptvhkkwddatavla
gdalqtlafelvthpgasasaevradlalslarasgaqgmvlgqaldiaaetaraplsld
eitrlqqgktgaligwsaqagarlaqadtaalkryaqalglafqiaddildvtgdsaqvg
kavgkdasagkatfvsllgldaararamslideacdslatygakadtlretarfvvrrth

SCOPe Domain Coordinates for d4llsa_:

Click to download the PDB-style file with coordinates for d4llsa_.
(The format of our PDB-style files is described here.)

Timeline for d4llsa_: