Lineage for d4lkra_ (4lkr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889197Species Shewanella oneidensis [TaxId:211586] [226734] (1 PDB entry)
  8. 2889198Domain d4lkra_: 4lkr A: [224696]
    automated match to d1xe3b_

Details for d4lkra_

PDB Entry: 4lkr (more details), 2.4 Å

PDB Description: Crystal structure of deoD-3 gene product from Shewanella oneidensis MR-1, NYSGRC target 029437
PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4lkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkra_ c.56.2.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
tahinaqptdfaetvimpgdplrakyiaetyltdavevtnvrnmlgytgyyqgqrisvmg
hgmgissmvlyghelinffgvkriirigslgatqqhvemrdvilaqaagtdsptnakrss
gyhmatsatfsllhkaytkanekgisvkvgnvfsgdlyydpdedmipalerfgvlgidme
vaglyglahqqgieslailtvsdhcltgeettaqerqlsfnnmielaletaln

SCOPe Domain Coordinates for d4lkra_:

Click to download the PDB-style file with coordinates for d4lkra_.
(The format of our PDB-style files is described here.)

Timeline for d4lkra_: