Lineage for d1e2vb1 (1e2v B:301-468,B:533-551)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772585Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 1772586Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 1772587Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 1772588Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries)
  8. 1772592Domain d1e2vb1: 1e2v B:301-468,B:533-551 [22469]
    Other proteins in same PDB: d1e2va2, d1e2vb2, d1e2vc2
    complexed with act, hec; mutant

Details for d1e2vb1

PDB Entry: 1e2v (more details), 1.85 Å

PDB Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii
PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d1e2vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2vb1 b.2.6.1 (B:301-468,B:533-551) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggqrgrgqvypdgkksnnXnvggfgqaete
ivlqnpar

SCOPe Domain Coordinates for d1e2vb1:

Click to download the PDB-style file with coordinates for d1e2vb1.
(The format of our PDB-style files is described here.)

Timeline for d1e2vb1: